PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID MELO3C008175P1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Cucurbitales; Cucurbitaceae; Benincaseae; Cucumis
Family WRKY
Protein Properties Length: 148aa    MW: 17227.4 Da    PI: 9.6685
Description WRKY family protein
Gene Model
Gene Model ID Type Source Coding Sequence
MELO3C008175P1genomeMELONOMICSView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1WRKY1023.5e-3269127159
                     ---SS-EEEEEEE--TT-SS-EEEEEE-STT---EEEEEE-SSSTTEEEEEEES--SS- CS
            WRKY   1 ldDgynWrKYGqKevkgsefprsYYrCtsagCpvkkkversaedpkvveitYegeHnhe 59 
                     ldDgy+WrKYGqK vk+++fprsYY+C+ +gC+vkk+++r ++d++vv +tYeg H h+
  MELO3C008175P1  69 LDDGYRWRKYGQKAVKNNKFPRSYYKCSNEGCKVKKQIQRLTKDEEVVLTTYEGVHSHP 127
                     59********************************************************7 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:2.20.25.801.3E-3254127IPR003657WRKY domain
SuperFamilySSF1182904.45E-2862128IPR003657WRKY domain
PROSITE profilePS5081129.25264129IPR003657WRKY domain
SMARTSM007743.1E-3669128IPR003657WRKY domain
PfamPF031063.6E-2670127IPR003657WRKY domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 148 aa     Download sequence    Send to blast
MDSSYINFLP TSSSSFFHNS LAMDDHDDEL EEESSLKKIK SEVSGGKLKK KKTRKRRFAF  60
ETRSQVDVLD DGYRWRKYGQ KAVKNNKFPR SYYKCSNEGC KVKKQIQRLT KDEEVVLTTY  120
EGVHSHPIEK PHDSFQNILT HMHIYSS*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1wj2_A5e-2859126774Probable WRKY transcription factor 4
2lex_A5e-2859126774Probable WRKY transcription factor 4
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankLN6818151e-149LN681815.1 Cucumis melo genomic scaffold, anchoredscaffold00008.
GenBankLN7132571e-149LN713257.1 Cucumis melo genomic chromosome, chr_3.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_008441319.11e-107PREDICTED: probable WRKY transcription factor 75
SwissprotQ9FYA28e-52WRK75_ARATH; Probable WRKY transcription factor 75
TrEMBLA0A0A0LT013e-66A0A0A0LT01_CUCSA; Uncharacterized protein
STRINGGSMUA_AchrUn_randomP21800_0011e-56(Musa acuminata)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF115634110
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G13080.12e-51WRKY DNA-binding protein 75